← NibNobble
Ad
10-Minute Gochujang Noodles

10-Minute Gochujang Noodles

Whip up a satisfyingly spicy and savory noodle dish in just 10 minutes. This recipe is designed for speed and flavor, making it perfect for a quick lunch or a hassle-free weeknight dinner when time is of the essence.

1
Servings
3m
Prep
7m
Cook
480
Calories
14g
Protein
This quick gochujang noodle recipe is incredibly versatile. Feel free to use your favorite quick-cooking noodles, such as instant ramen (discard the seasoning packet), thin spaghetti, or even pre-cooked udon for a chewier texture.
Koreanvegetariandairy-freeweeknightquick-mealcozy

Ingredients

Equipment

  • Small saucepan
  • Whisk
  • Mixing bowl
Ad

Steps

  1. 1. Prep Ingredients

  2. 2. Cook Noodles

  3. 3. Make Sauce and Combine

Creamy Gochujang Noodles Variation

For a creamier texture, stir in a tablespoon of heavy cream, milk, or a non-dairy alternative like oat milk at the end. This addition mellows the spice slightly and adds a rich, luscious mouthfeel. You can also melt a slice of American cheese or a sprinkle of shredded mozzarella into the hot noodles for an extra indulgent, cheesy kick.

Gochujang Noodles for One: Perfectly Portioned

This recipe is designed to make a single, satisfying serving, minimizing waste and making cleanup easy. It's ideal for solo diners or anyone looking for a quick, personal meal. You can easily double or triple the ingredients if you are cooking for more people, adjusting spice levels to your preference.

Elevate with Gochujang Butter Noodles

Infuse extra richness and a delightful depth of flavor by melting a tablespoon of butter with the sauce ingredients. The butter adds a silky texture that beautifully complements the gochujang's spice and umami. For an even nuttier aroma, try browning the butter slightly before mixing in the other sauce components.

Frequently asked questions

What kind of noodles work best for 10-minute gochujang noodles?
Instant ramen noodles (without the seasoning packet), thin spaghetti, or pre-cooked udon noodles are excellent choices due to their quick cooking time. Vermicelli or thin rice noodles also work well.
Can I make gochujang noodles less spicy?
Yes, you can reduce the amount of gochujang by half, or add a touch more sugar or a splash of milk to mellow the heat. Adjust to your personal spice preference.
What can I add to my gochujang noodles for extra flavor or protein?
Top with a fried egg, sautéed mushrooms, spinach, or leftover cooked chicken or tofu for added protein and vegetables. A drizzle of chili oil also adds another layer of flavor and heat.
How should I store leftover gochujang noodles?
These noodles are best enjoyed fresh. If you have leftovers, store them in an airtight container in the refrigerator for up to 1 day. The noodles may absorb more sauce and become softer over time.

Cook something else?

NibNobble is a recipe generator, not a recipe box. Type any craving and get a brand-new recipe every time.

Make your own with NibNobble